PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g16590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 517aa    MW: 57350.4 Da    PI: 7.2494
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g16590genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA504.1e-16741135
       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
               C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Tp7g16590  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
               ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.4E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.38E-11546No hitNo description
CDDcd002023.12E-16655No hitNo description
PfamPF003206.7E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF139191.7E-9275365IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLVNYTPLHA RADGEENEDH  60
QKYQRMKSIS LSIKNKETKM LKRKAIQENL YIKRPDLEIN YGLKKAVIEE DASNRSSSGS  120
AISNSESCAQ FSSADGSELT GPSQSNTWDT TVPCKRRTCV GRPKSSSVEK LTKDLYNILQ  180
EQQFSCLSVS SEDDLLFENE MSMVSVEIGH GSVLMRNPHS FPREEESEAS SLSSVENKSS  240
ISEAYSHSVK RAEIGAERGS ESVGQALDQE QLKRTKSHSG RVHVLGSHNS PLCSIDLKDV  300
FNFDEFVEQF TEEEQKKMMK LLPQIDSVTL PDSLRMMFES AQFKENFSLF QKLIADGVFE  360
LPSSSGANIE DIRTFKKLAL SDFNKSRLVE SYNLLKEGGK GPGDSVTTTS KSSNPNVPRN  420
IVTIKRRCEN QTQSKSESRG LMRSPKSVTK MKASHEGKVM TEKNGSCFSP RSLASVFAQE  480
SGSLFGYEGN CSSDQELLLL DLPSNGSFPQ AELLHQL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532400.0AK353240.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-27-J12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414213.10.0hypothetical protein EUTSA_v10024940mg
SwissprotQ8W4H10.0GAT26_ARATH; GATA transcription factor 26
TrEMBLE4MXJ30.0E4MXJ3_EUTHA; mRNA, clone: RTFL01-27-J12
TrEMBLV4P7U00.0V4P7U0_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.7__2553__AT4G17570.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.30.0GATA transcription factor 26